PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim10g080960.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family G2-like
Protein Properties Length: 267aa    MW: 29196 Da    PI: 8.9088
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim10g080960.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like97.78.5e-3188141155
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         +prl+Wtp+LH+rFv+av+qL G+++A+Pkti++lm+v+gLt+e+v+SHLQkYRl
  Sopim10g080960.0.1  88 RPRLVWTPQLHKRFVDAVAQL-GIKNAVPKTIMQLMSVDGLTRENVASHLQKYRL 141
                         59*******************.********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.52E-2085145IPR009057Homeodomain-like
PROSITE profilePS5129411.00485144IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.7E-3187146IPR009057Homeodomain-like
TIGRFAMsTIGR015574.6E-2489141IPR006447Myb domain, plants
PfamPF002494.1E-891140IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 267 aa     Download sequence    Send to blast
MREEDSNWFA KWEEELPSPK ELMPLSQTLI TPNLAIAFDI QNPNTPNPKI TPLVHTLSSA  60
EFDSNSAELG GMAGSSGVGD EPARTLKRPR LVWTPQLHKR FVDAVAQLGI KNAVPKTIMQ  120
LMSVDGLTRE NVASHLQKYR LYLKRMQGLS HSGSVSGAGV DPATDHLFAS SPVPAHFLHP  180
GRGNSDHYMP FVPMSAVVGH APQFQQQYRH FGSPTNGQFE VPFLPRQSQQ PAQRMGTSVH  240
SSSPALESAT TANGRKVLTL FPNRDD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A8e-2087146463ARR10-B
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755220.0HG975522.1 Solanum lycopersicum chromosome ch10, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004249324.10.0PREDICTED: transcription factor PCL1-like
SwissprotQ9SNB44e-48PCL1_ARATH; Transcription factor LUX
TrEMBLK4D2Y30.0K4D2Y3_SOLLC; Uncharacterized protein
STRINGSolyc10g080960.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24322354
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G10760.12e-91G2-like family protein